Structure of PDB 1zbb Chain F

Receptor sequence
>1zbbF (length=94) Species: 8355 (Xenopus laevis) [Search protein sequence]
SGRGKGKKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVL
KVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
3D structure
PDB1zbb X-ray structure of a tetranucleosome and its implications for the chromatin fibre.
ChainF
Resolution9.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna F R17 H18 R19 T30 P32 R36 R9 H10 R11 T22 P24 R28
BS02 dna F S1 G2 R3 K12 K16 R45 I46 S47 G48 K79 T80 S1 G2 R3 K7 K8 R37 I38 S39 G40 K71 T72
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1zbb, PDBe:1zbb, PDBj:1zbb
PDBsum1zbb
PubMed16001076
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]