Structure of PDB 1vf5 Chain F

Receptor sequence
>1vf5F (length=33) Species: 83541 (Mastigocladus laminosus) [Search protein sequence]
MTEEMLYAALLSFGLIFVGWGLGVLLLKIQGAE
3D structure
PDB1vf5 Structure of the Cytochrome B6F Complex of Oxygenic Photosynthesis: Tuning the Cavity
ChainF
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide F L15 G19 W20 G23 L26 L27 L15 G19 W20 G23 L26 L27
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0009512 cytochrome b6f complex
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1vf5, PDBe:1vf5, PDBj:1vf5
PDBsum1vf5
PubMed14526088
UniProtP83796|PETM_MASLA Cytochrome b6-f complex subunit 7 (Gene Name=petM)

[Back to BioLiP]