Structure of PDB 1qiy Chain F

Receptor sequence
>1qiyF (length=30) Species: 9606 (Homo sapiens) [Search protein sequence]
FVNQYLCGSHLVEALYLVCGERGFFYTPKT
3D structure
PDB1qiy Structural Consequences of the B5 Histidine --> Tyrosine Mutation in Human Insulin Characterized by X-Ray Crystallography and Conformational Analysis.
ChainF
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide F F1 V2 F1 V2
BS02 peptide F C7 L11 V18 C19 R22 G23 F24 F25 C7 L11 V18 C19 R22 G23 F24 F25
BS03 IPH F L11 A14 L11 A14
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1qiy, PDBe:1qiy, PDBj:1qiy
PDBsum1qiy
PubMed10508408
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]