Structure of PDB 1pue Chain F

Receptor sequence
>1pueF (length=89) Species: 10090 (Mus musculus) [Search protein sequence]
KIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKG
NRKKMTYEKMARALRNYGKTGEVKKVKKKLTYQFSGEVL
3D structure
PDB1pue A new pattern for helix-turn-helix recognition revealed by the PU.1 ETS-domain-DNA complex.
ChainF
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna F K171 S205 K208 R222 R232 R235 K245 K249 L250 K1 S35 K38 R52 R62 R65 K75 K79 L80
BS02 dna F I172 R173 L174 W215 K219 N221 K223 K229 Y237 I2 R3 L4 W45 K49 N51 K53 K59 Y67
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1pue, PDBe:1pue, PDBj:1pue
PDBsum1pue
PubMed8602247
UniProtP17433|SPI1_MOUSE Transcription factor PU.1 (Gene Name=Spi1)

[Back to BioLiP]