Structure of PDB 1p3o Chain F

Receptor sequence
>1p3oF (length=79) Species: 8355 (Xenopus laevis) [Search protein sequence]
DNIQGITKPAIRRLARRGGAKRISGLIYEETRGVLKVFLENVIRDAVTYT
EHAKRKTVTAMDVVYALKRQGRTLYGFGG
3D structure
PDB1p3o Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
ChainF
Resolution2.75 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna F R235 R245 I246 G248 R278 K279 T280 R12 R22 I23 G25 R55 K56 T57
BS02 dna F R236 R245 R13 R22
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1p3o, PDBe:1p3o, PDBj:1p3o
PDBsum1p3o
PubMed14739929
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]