Structure of PDB 1odb Chain F

Receptor sequence

>1odbF (length=90) Species: 9606 (Homo sapiens) [Search protein sequence]

STKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKD
KAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTH

3D structure

PDB

1odb Structure of the Human S100A12-Copper Complex: Implications for Host-Parasite Defence

Chain

Resolution

2.19 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CU	F	H85 H89	H86 H90
BS02	CU	F	H15 D25	H16 D26
BS03	CA	F	S18 K21 G22 H23 T26 E31	S19 K22 G23 H24 T27 E32
BS04	CA	F	D61 N63 D65 Q67 E72	D62 N64 D66 Q68 E73

Gene Ontology

	Molecular Function
GO:0005507	copper ion binding
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0042802	identical protein binding
GO:0046872	metal ion binding
GO:0048306	calcium-dependent protein binding
GO:0050786	RAGE receptor binding

	Biological Process
GO:0002548	monocyte chemotaxis
GO:0006805	xenobiotic metabolic process
GO:0006954	inflammatory response
GO:0030593	neutrophil chemotaxis
GO:0031640	killing of cells of another organism
GO:0042742	defense response to bacterium
GO:0043123	positive regulation of canonical NF-kappaB signal transduction
GO:0043406	positive regulation of MAP kinase activity
GO:0043542	endothelial cell migration
GO:0045087	innate immune response
GO:0045576	mast cell activation
GO:0050729	positive regulation of inflammatory response
GO:0050832	defense response to fungus
GO:0051092	positive regulation of NF-kappaB transcription factor activity
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide

External links

PDB	RCSB:1odb, PDBe:1odb, PDBj:1odb
PDBsum	1odb
PubMed	12777802
UniProt	P80511\|S10AC_HUMAN Protein S100-A12 (Gene Name=S100A12)