Structure of PDB 1mr3 Chain F

Receptor sequence
>1mr3F (length=177) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
ASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVE
TVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAR
EVMQRMLNEDELRNAVWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWF
IQSTCATSGEGLYEGLEWLSNNLKNQS
3D structure
PDB1mr3 Structures of yeast ARF2 and ARL1: distinct roles for the N terminus in the structure and function of ARF family GTPases.
ChainF
Resolution1.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 G3D F D26 G27 G29 K30 T31 T32 N126 K127 D129 C159 A160 T161 D22 G23 G25 K26 T27 T28 N122 K123 D125 C155 A156 T157
BS02 PDO F N52 E54 V65 D67 N48 E50 V61 D63
BS03 PDO F D72 R73 D68 R69
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
Biological Process
GO:0006886 intracellular protein transport
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0016236 macroautophagy
Cellular Component
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1mr3, PDBe:1mr3, PDBj:1mr3
PDBsum1mr3
PubMed11535602
UniProtP19146|ARF2_YEAST ADP-ribosylation factor 2 (Gene Name=ARF2)

[Back to BioLiP]