Structure of PDB 1m8t Chain F |
>1m8tF (length=119) Species: 8665 (Ophiophagus hannah) [Search protein sequence] |
HLVQFNGMIRCTIPGSIPWWDYSDYGCYCGSGGSGTPVDELDRCCQVHDN CYTQAQQLTECSPYSKRYSYDCSEGTLTCKADNDECAAFVCDCDRVAAIC FAGAPYNKENINIDTTTRC |
|
PDB | 1m8t Structure of a king cobra phospholipase A2 determined from a hemihedrally twinned crystal. |
Chain | F |
Resolution | 2.1 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
F |
Y28 G30 G32 D49 |
Y28 G30 G32 D49 |
|
|
|
|