Structure of PDB 1m1p Chain F

Receptor sequence

>1m1pF (length=88) Species: 70863 (Shewanella oneidensis) [Search protein sequence]

DQKLSDFHAESGGCESCHKDGTPSADGAFEFAQCQSCHGKLSEMDAVHKP
HDGNLVCADCHAVHDMNVGQKPTCESCHDDGRTSASVL

3D structure

PDB

1m1p Crystal structures at atomic resolution reveal the novel concept of 'electron-harvesting' as a role for the small tetraheme cytochrome c

Chain

Resolution

1.55 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEC	F	C38 H39	C37 H38
BS02	HEC	F	H9 C15 C18 H19 P24 V64 H65	H8 C14 C17 H18 P23 V63 H64
BS03	HEC	F	P51 H52 L56 T74 C75 C78 H79 R83	P50 H51 L55 T73 C74 C77 H78 R82
BS04	HEC	F	L5 F8 H9 Q34 C35 C38 H39 H62	L4 F7 H8 Q33 C34 C37 H38 H61
BS05	HEC	F	H39 L42 M45 D46 H49 H52 C58 C61 H62 K72 P73 L89	H38 L41 M44 D45 H48 H51 C57 C60 H61 K71 P72 L88

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding

	Cellular Component
GO:0042597	periplasmic space

External links