Structure of PDB 1k73 Chain F

Receptor sequence

>1k73F (length=140) Species: 2238 (Haloarcula marismortui) [Search protein sequence]

FHEMREPRIEKVVVHMGIGHANAEDILGEITGQMPVRTKAKRTVGEFDIR
EGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGLDVTVNL
VRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV

3D structure

PDB

1k73 Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit

Chain

Resolution

3.01 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	K20 V22 H24 T52 A54 K55 R56 E60 K72 Q97 D99 D100 T101 N103 S105 F106 G107 D129 N133 R156	K11 V13 H15 T38 A40 K41 R42 E46 K58 Q83 D85 D86 T87 N89 S91 F92 G93 D95 N99 R122
BS02	rna	F	E12 M13 R14 Q47 M48 V50 R51 T74 R76 P137 G138 R140 V141 K143 R144 D145 R149 P152 K154 H155	E3 M4 R5 Q33 M34 V36 R37 T60 R62 P103 G104 R106 V107 K109 R110 D111 R115 P118 K120 H121

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:1k73, PDBe:1k73, PDBj:1k73
PDBsum	1k73
PubMed	12860128
UniProt	P14124\|RL5_HALMA Large ribosomal subunit protein uL5 (Gene Name=rpl5)