Structure of PDB 1i94 Chain F |
>1i94F (length=101) Species: 274 (Thermus thermophilus) [Search protein sequence] |
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAY PIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLAN A |
|
PDB | 1i94 Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3. |
Chain | F |
Resolution | 3.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
F |
V91 K92 |
V91 K92 |
|
|
|
|