Structure of PDB 1i5l Chain F |
>1i5lF (length=72) Species: 2234 (Archaeoglobus fulgidus) [Search protein sequence] |
PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGE VVRKVGSVVIRGDTVVFVSPAP |
|
PDB | 1i5l RNA binding in an Sm core domain: X-ray structure and functional analysis of an archaeal Sm protein complex. |
Chain | F |
Resolution | 2.75 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
F |
H37 N39 R63 D65 |
H35 N37 R61 D63 |
|
|
|
|