Structure of PDB 1i3o Chain F |
>1i3oF (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] |
THADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSLTPRELASAGLYYTG IGDQVQCFACGGKLKNWEPGDRAWSEHRRHFPNCFFVLGRNLN |
|
PDB | 1i3o Structural basis for the inhibition of caspase-3 by XIAP. |
Chain | F |
Resolution | 2.7 Å |
3D structure |
|
|
Enzyme Commision number |
2.3.2.27: RING-type E3 ubiquitin transferase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
F |
C200 C203 H220 C227 |
C57 C60 H77 C84 |
|
|
|