Structure of PDB 1g2f Chain F

Receptor sequence
>1g2fF (length=87) Species: 10090 (Mus musculus) [Search protein sequence]
ERPYACPVESCDRRFSQKTNLDTHIRIHTGQKPFQCRICMRNFSQQASLN
AHIRTHTGEKPFACDICGRKFATLHTRTRHTKIHLRQ
3D structure
PDB1g2f Beyond the "recognition code": structures of two Cys2His2 zinc finger/TATA box complexes.
ChainF
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna F R214 Q218 N221 H225 R242 Q246 S249 H253 R270 T277 R280 H281 R287 R13 Q17 N20 H24 R41 Q45 S48 H52 R69 T76 R79 H80 R86
BS02 dna F T220 H276 R280 T19 H75 R79
BS03 ZN F C207 C212 H225 H229 C6 C11 H24 H28
BS04 ZN F C237 C240 H253 H257 C36 C39 H52 H56
BS05 ZN F C265 C268 H281 H285 C64 C67 H80 H84
External links
PDB RCSB:1g2f, PDBe:1g2f, PDBj:1g2f
PDBsum1g2f
PubMed11587646
UniProtP08046|EGR1_MOUSE Early growth response protein 1 (Gene Name=Egr1)

[Back to BioLiP]