Structure of PDB 1g1x Chain F

Receptor sequence
>1g1xF (length=98) Species: 274 (Thermus thermophilus) [Search protein sequence]
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAY
PIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFL
3D structure
PDB1g1x Structure of the S15,S6,S18-rRNA complex: assembly of the 30S ribosome central domain.
ChainF
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F R36 E38 R36 E38
BS02 rna F Y4 E69 N73 V90 V91 K92 Y4 E69 N73 V90 V91 K92
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1g1x, PDBe:1g1x, PDBj:1g1x
PDBsum1g1x
PubMed10753109
UniProtQ5SLP8|RS6_THET8 Small ribosomal subunit protein bS6 (Gene Name=rpsF)

[Back to BioLiP]