Structure of PDB 1fka Chain F |
>1fkaF (length=97) Species: 274 (Thermus thermophilus) [Search protein sequence] |
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAY PIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPF |
|
PDB | 1fka Structure of functionally activated small ribosomal subunit at 3.3 angstroms resolution. |
Chain | F |
Resolution | 3.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
F |
E69 V90 V91 K92 |
E69 V90 V91 K92 |
|
|
|
|