Structure of PDB 1f66 Chain F

Receptor sequence
>1f66F (length=86) Species: 10090 (Mus musculus) [Search protein sequence]
RHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVI
RDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
3D structure
PDB1f66 Crystal structure of a nucleosome core particle containing the variant histone H2A.Z.
ChainF
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna F R235 R245 I246 G248 R278 K279 T280 R19 R29 I30 G32 R62 K63 T64
BS02 dna F H218 P232 R236 H2 P16 R20
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0061644 protein localization to CENP-A containing chromatin
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0043505 CENP-A containing nucleosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1f66, PDBe:1f66, PDBj:1f66
PDBsum1f66
PubMed11101893
UniProtP62806|H4_MOUSE Histone H4 (Gene Name=H4c1)

[Back to BioLiP]