Structure of PDB 1ev6 Chain F

Receptor sequence
>1ev6F (length=30) Species: 9606 (Homo sapiens) [Search protein sequence]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
3D structure
PDB1ev6 R6 Hexameric Insulin Complexed with m-Cresol or Resorcinol
ChainF
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide F F1 V2 F1 V2
BS02 peptide F L6 S9 H10 L6 S9 H10
BS03 peptide F C7 L11 V18 C19 R22 G23 F24 Y26 T30 C7 L11 V18 C19 R22 G23 F24 Y26 T30
BS04 peptide F H5 G8 S9 V12 E13 Y16 G23 F24 F25 Y26 P28 H5 G8 S9 V12 E13 Y16 G23 F24 F25 Y26 P28
BS05 peptide F N3 H10 N3 H10
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1ev6, PDBe:1ev6, PDBj:1ev6
PDBsum1ev6
PubMed11092919
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]