Structure of PDB 1ce8 Chain F

Receptor sequence

>1ce8F (length=379) Species: 562 (Escherichia coli)

IKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQ
IVTLTYPHIGNVGTNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSY
LKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDAALALEKARAFP
GLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPQAKKEDELPFHVVAYDFGA
KRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYA
ITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNHPVKDVE
KNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQ
GHPEASPGPHDAAPLFDHFIELIEQYRKT

3D structure

• PDB: 1ce8 The binding of inosine monophosphate to Escherichia coli carbamoyl phosphate synthetase.
• Chain: F
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C269 H353 E355
• Catalytic site (residue number reindexed from 1): C268 H352 E354
• Enzyme Commision number: 6.3.5.5: carbamoyl-phosphate synthase (glutamine-hydrolyzing).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ORN	F	R120 R123	R119 R122

Gene Ontology

Molecular Function

• GO:0004088 carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
• GO:0004359 glutaminase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016874 ligase activity
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process
• GO:0006221 pyrimidine nucleotide biosynthetic process
• GO:0006526 L-arginine biosynthetic process
• GO:0006541 glutamine metabolic process
• GO:0019856 pyrimidine nucleobase biosynthetic process
• GO:0044205 'de novo' UMP biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005951 carbamoyl-phosphate synthase complex

External links

• PDB: RCSB:1ce8, PDBe:1ce8, PDBj:1ce8
• PDBsum: 1ce8
• PubMed: 10428826
• UniProt: P0A6F1|CARA_ECOLI Carbamoyl phosphate synthase small chain (Gene Name=carA)