Structure of PDB 1bcp Chain F |
>1bcpF (length=98) Species: 520 (Bordetella pertussis) [Search protein sequence] |
LPTHLYKNFTVQELALKLKGKNQEFCLTAFMSGRSLVRACLSDAGHEHDT WFDTMLGFAISAYALKSRIALTVEDSPYPGTPGDLLELQICPLNGYCE |
|
PDB | 1bcp Crystal structure of the pertussis toxin-ATP complex: a molecular sensor. |
Chain | F |
Resolution | 2.7 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ATP |
F |
T55 G58 F59 S62 |
T54 G57 F58 S61 |
|
|
|
|