Structure of PDB 8hfr Chain Ez

Receptor sequence

>8hfrEz (length=290) Species: 559292 (Saccharomyces cerevisiae S288C)

DAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRF
TNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLI
ARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTT
GARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGGHVS
QYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADPAFKP
TEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAG

3D structure

• PDB: 8hfr Nuclear export of pre-60S particles through the nuclear pore complex.
• Chain: Ez
• Resolution: 2.64 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Ez	R15 F16 Q17 P19 R23 D29 R35 L36 K43 Y44 K48 L113 P139 R140 P141 F142 F145 I148 L150 P174 H175 S176 N178 R179	R10 F11 Q12 P14 R18 D24 R30 L31 K38 Y39 K43 L108 P134 R135 P136 F137 F140 I143 L145 P169 H170 S171 N173 R174
BS02	rna	Ez	S13 T18 F20 R21 R22 R24 T28 Y30 R33 R50 R54 T56 N57 K58 Q63 I69 D72 V74 G91 N94 Q151 T154 T155 R158 Y198 H203 Y207 E221 L222 P255 T256 F260 Y265 A266 E268 S269 Y272 T275 L277	S8 T13 F15 R16 R17 R19 T23 Y25 R28 R45 R49 T51 N52 K53 Q58 I64 D67 V69 G86 N89 Q146 T149 T150 R153 Y193 H198 Y202 E216 L217 P250 T251 F255 Y260 A261 E263 S264 Y267 T270 L272

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8hfr, PDBe:8hfr, PDBj:8hfr
• PDBsum: 8hfr
• PubMed: 37258668
• UniProt: P26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)