Structure of PDB 7a8y Chain EaE

Receptor sequence

>7a8yEaE (length=94) Species: 562 (Escherichia coli)

SCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGA
AAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTA

3D structure

• PDB: 7a8y Structure and diffusive dynamics of aspartate alpha-decarboxylase (ADC) liganded with D-serine in aqueous solution.
• Chain: EaE
• Resolution: 1.75 Å

Enzymatic activity

• Enzyme Commision number: 4.1.1.11: aspartate 1-decarboxylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	EaE	G37 L39 N41 E42 A43 Y58 V91 T92 P94 E97	G13 L15 N17 E18 A19 Y34 V67 T68 P70 E73
BS02	peptide	EaE	F32 A36 G37 I69 S70 V71 N72 G73 H77 S80 V81 D83 I84 V85 I86 I87 A88 S89 F90 V91 T92 M93 P94 D95 A98 W101 P103 N104 V105 A106 F108 G110 N112	F8 A12 G13 I45 S46 V47 N48 G49 H53 S56 V57 D59 I60 V61 I62 I63 A64 S65 F66 V67 T68 M69 P70 D71 A74 W77 P79 N80 V81 A82 F84 G86 N88
BS03	PYR	EaE	S25 C26 T57 Y58 N72	S1 C2 T33 Y34 N48
BS04	SER	EaE	S25 T57 A74 A75	S1 T33 A50 A51
BS05	DSN	EaE	S25 Y58	S1 Y34

Gene Ontology

Molecular Function

• GO:0004068 aspartate 1-decarboxylase activity

Biological Process

• GO:0006523 alanine biosynthetic process

External links

• PDB: RCSB:7a8y, PDBe:7a8y, PDBj:7a8y
• PDBsum: 7a8y
• PubMed: 35980136
• UniProt: A0A4Y8GT61