Structure of PDB 8bqs Chain EN |
>8bqsEN (length=145) Species: 312017 (Tetrahymena thermophila SB210) [Search protein sequence] |
QLDFSHFDKAFENKYDIVAPEFGDLHQKRAEFIAKNQGTYRPVPLVPNNI KGLIPKTCRLPATRNWYRRTSSFERNGFFNIHTPVLNTKMIPWLLFIVLT WGWSSFQIGGYNYERFDDNGERRNTLYWKLSPVEFPQSKLWNRPS |
|
PDB | 8bqs Structural basis of mitochondrial membrane bending by I-II-III2-IV2 supercomplex |
Chain | EN |
Resolution | 2.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
UQ8 |
EN |
V102 W105 G106 |
V98 W101 G102 |
|
|
|