Structure of PDB 7zux Chain EI

Receptor sequence

>7zuxEI (length=218) Species: 4932 (Saccharomyces cerevisiae)

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MLSCAGADRLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEG
LRRARYKFPGQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLS
KKGSLENNIREFPEYFAA

3D structure

• PDB: 7zux Structural basis for clearing of ribosome collisions by the RQT complex.
• Chain: EI
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	EI	Y11 E56 L57 K202 K203 G204 S205 L206 F217	Y10 E55 L56 K201 K202 G203 S204 L205 F216
BS02	rna	EI	R3 R4 P5 A6 R7 K13 K15 Y17 Y22 R24 D35 K39 K40 E63 A64 K74 R90 H92 F94 R98 N100 C105 G107 A108 D109 R110 Q112 G114 M115 R116 G117 W119 G120 Y157 K158 G194 F196 K198	R2 R3 P4 A5 R6 K12 K14 Y16 Y21 R23 D34 K38 K39 E62 A63 K73 R89 H91 F93 R97 N99 C104 G106 A107 D108 R109 Q111 G113 M114 R115 G116 W118 G119 Y156 K157 G193 F195 K197
BS03	rna	EI	K101 L103 R110	K100 L102 R109

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006415 translational termination

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7zux, PDBe:7zux, PDBj:7zux
• PDBsum: 7zux
• PubMed: 36801861
• UniProt: P41805|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)