Structure of PDB 7aju Chain EH

Receptor sequence

>7ajuEH (length=237) Species: 559292 (Saccharomyces cerevisiae S288C)

MSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAKGKS
GVQTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYM
AFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGIL
EDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEE
LSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILTV

3D structure

• PDB: 7aju Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
• Chain: EH
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	EH	F80 S81	F80 S81

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0030145 manganese ion binding

Biological Process

• GO:0000288 nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
• GO:0000467 exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000956 nuclear-transcribed mRNA catabolic process
• GO:0006364 rRNA processing
• GO:0006396 RNA processing
• GO:0006401 RNA catabolic process
• GO:0034475 U4 snRNA 3'-end processing
• GO:0071034 CUT catabolic process
• GO:0071035 nuclear polyadenylation-dependent rRNA catabolic process
• GO:0071038 TRAMP-dependent tRNA surveillance pathway
• GO:0071051 poly(A)-dependent snoRNA 3'-end processing

Cellular Component

• GO:0000176 nuclear exosome (RNase complex)
• GO:0000177 cytoplasmic exosome (RNase complex)
• GO:0000178 exosome (RNase complex)
• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:7aju, PDBe:7aju, PDBj:7aju
• PDBsum: 7aju
• PubMed: 33326748
• UniProt: Q08285|RRP40_YEAST Exosome complex component RRP40 (Gene Name=RRP40)