Structure of PDB 8g60 Chain EF

Receptor sequence

>8g60EF (length=443) Species: 9606 (Homo sapiens) [Search protein sequence]

EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGS
FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMI
TGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVN
KMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLE
PSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDV
YKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEAL
PGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQI
SAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVD
MVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAA

3D structure

PDB

8g60 mRNA decoding in human is kinetically and structurally distinct from bacteria.

Chain

Resolution

2.54 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.5.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	EF	R37 K255 G258 I259 K290	R34 K252 G255 I256 K287
BS02	rna	EF	K100 N101 Y254 I256 I259 V262 S291 E293 H296 G309 R322 G356 Y357 V360 K408 R430	K97 N98 Y251 I253 I256 V259 S288 E290 H293 G306 R319 G353 Y354 V357 K405 R427
BS03	PHE	EF	V264 H295 N307	V261 H292 N304
BS04	GSP	EF	D17 S18 G19 K20 S21 T22 S53 F54 I71 T72 G94 H95 N153 K154 D156 G195 W196	D14 S15 G16 K17 S18 T19 S50 F51 I68 T69 G91 H92 N150 K151 D153 G192 W193
BS05	ZIY	EF	Y141 I181 Q343 I345 L347 I379 R381 R382 S383 F415 R423 G436	Y138 I178 Q340 I342 L344 I376 R378 R379 S380 F412 R420 G433
BS06	MG	EF	S21 T72	S18 T69

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003746	translation elongation factor activity
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0016787	hydrolase activity
GO:0019900	kinase binding
GO:0019901	protein kinase binding
GO:0060090	molecular adaptor activity

	Biological Process
GO:0006412	translation
GO:0006414	translational elongation
GO:0044829	positive regulation by host of viral genome replication
GO:0071364	cellular response to epidermal growth factor stimulus
GO:1904714	regulation of chaperone-mediated autophagy

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0005853	eukaryotic translation elongation factor 1 complex
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0022626	cytosolic ribosome
GO:0030864	cortical actin cytoskeleton
GO:0032587	ruffle membrane
GO:0034774	secretory granule lumen
GO:0070062	extracellular exosome
GO:0098574	cytoplasmic side of lysosomal membrane
GO:1904813	ficolin-1-rich granule lumen

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8g60, PDBe:8g60, PDBj:8g60
PDBsum	8g60
PubMed	37020024
UniProt	P68104\|EF1A1_HUMAN Elongation factor 1-alpha 1 (Gene Name=EEF1A1)

[Back to BioLiP]