Structure of PDB 8g5z Chain EF

Receptor sequence

>8g5zEF (length=444) Species: 9606 (Homo sapiens) [Search protein sequence]

EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGS
FKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMI
TGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVN
KMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLE
PSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDV
YKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEAL
PGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQI
SAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVD
MVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAG

3D structure

PDB

8g5z mRNA decoding in human is kinetically and structurally distinct from bacteria.

Chain

Resolution

2.64 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.5.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	EF	R37 K255 G258 I259 K290 K313	R34 K252 G255 I256 K287 K310
BS02	rna	EF	H15 K51 S53 R69 H95 N130	H12 K48 S50 R66 H92 N127
BS03	rna	EF	L63 I73 D74 F98 K100 N101 Y254 I256 I259 V262 S291 E293 H296 H349 P350 G356 Y357 V360 M429 R430	L60 I70 D71 F95 K97 N98 Y251 I253 I256 V259 S288 E290 H293 H346 P347 G353 Y354 V357 M426 R427
BS04	PHE	EF	M294 H295	M291 H292
BS05	GSP	EF	D17 G19 K20 S21 T22 S53 F54 T72 G94 H95 N153 K154 D156 S194 G195 W196	D14 G16 K17 S18 T19 S50 F51 T69 G91 H92 N150 K151 D153 S191 G192 W193
BS06	ZIY	EF	Y141 T142 K146 I181 Q343 I345 R381 R382 R423 V435 G436 V437	Y138 T139 K143 I178 Q340 I342 R378 R379 R420 V432 G433 V434
BS07	MG	EF	S21 T72 D91	S18 T69 D88
BS08	MG	EF	F54 G70	F51 G67

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003746	translation elongation factor activity
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0016787	hydrolase activity
GO:0019001	guanyl nucleotide binding
GO:0019900	kinase binding
GO:0019901	protein kinase binding
GO:0060090	molecular adaptor activity

	Biological Process
GO:0006412	translation
GO:0006414	translational elongation
GO:0044829	positive regulation by host of viral genome replication
GO:0071364	cellular response to epidermal growth factor stimulus

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0005886	plasma membrane
GO:0022626	cytosolic ribosome
GO:0030864	cortical actin cytoskeleton
GO:0032587	ruffle membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8g5z, PDBe:8g5z, PDBj:8g5z
PDBsum	8g5z
PubMed	37020024
UniProt	P68105\|EF1A1_RABIT Elongation factor 1-alpha 1 (Gene Name=EEF1A1)

[Back to BioLiP]