Structure of PDB 8q3e Chain EEE

Receptor sequence
>8q3eEEE (length=98) Species: 9606 (Homo sapiens) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB8q3e Viral peptide conjugates for metal-warhead delivery to chromatin.
ChainEEE
Resolution2.174 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide EEE Q125 R129 R134 A135 Q88 R92 R97 A98
BS02 dna EEE H39 R40 Y41 G44 V46 A47 R49 R63 K64 L65 P66 R69 R83 H2 R3 Y4 G7 V9 A10 R12 R26 K27 L28 P29 R32 R46
BS03 dna EEE R40 Y41 R42 P43 T45 R72 R83 F84 Q85 R116 V117 T118 M120 R3 Y4 R5 P6 T8 R35 R46 F47 Q48 R79 V80 T81 M83
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8q3e, PDBe:8q3e, PDBj:8q3e
PDBsum8q3e
PubMed38495982
UniProtP68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]