Structure of PDB 3jag Chain EE

Receptor sequence

>3jagEE (length=262) Species: 9986 (Oryctolagus cuniculus)

ARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNK
LKYALTGDEVKKICMQRFIKIDGKVRADITYPAGFMDVISIDKTGENFRL
IYDTKGRFAVHRITPEEAKYKLCKVRKIFVGTKGIPHLVTHDARTIRYPD
PLIKMNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERH
PGSFDVVHVKDANGNSFATRLSNIFVIGKGNKPWISLPRGKGIRLTIAEE
RDKRLAAKQSSG

3D structure

• PDB: 3jag Structural basis for stop codon recognition in eukaryotes.
• Chain: EE
• Resolution: 3.65 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	EE	R3 G4 P5 K6 K7 H8 K10 V12 K16 M19 D21 K22 V26 F27 A28 P29 T33 G34 K37 L38 R49 T57 G58 D59 M66 K75 R77 K106 R108 K128 F130 V131 G132 K134 G135 V140 A144 T146 R148 K155 G186 A187 N188 H201 P202 A219 R221 R240 I248 R255	R2 G3 P4 K5 K6 H7 K9 V11 K15 M18 D20 K21 V25 F26 A27 P28 T32 G33 K36 L37 R48 T56 G57 D58 M65 K74 R76 K105 R107 K127 F129 V130 G131 K133 G134 V139 A143 T145 R147 K154 G185 A186 N187 H200 P201 A218 R220 R239 I247 R254

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022626 cytosolic ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3jag, PDBe:3jag, PDBj:3jag
• PDBsum: 3jag
• PubMed: 26245381
• UniProt: G1TK17|RS4X_RABIT Small ribosomal subunit protein eS4 (Gene Name=RPS4X)