Structure of PDB 8wql Chain ED |
>8wqlED (length=78) Species: 153964 (Arthrospira sp. FACHB-439) [Search protein sequence] |
GTTGERPFGDIITSVRYWVIHSLTIPALFIAGWLFVSTGLAYDAFGTPRP NEYFTQERQELPIITERQDSKTQIQQFI |
|
PDB | 8wql Structure of in situ PBS-PSII supercomplex at 3.5 Angstroms resolution. |
Chain | ED |
Resolution | 3.5 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
HEM |
ED |
R18 Y19 H23 T26 |
R16 Y17 H21 T24 |
|
|
|