Structure of PDB 6bok Chain ED

Receptor sequence

>6bokED (length=99) Species: 262724 (Thermus thermophilus HB27)

RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMR
KAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA

3D structure

• PDB: 6bok Conformational Control of Translation Termination on the 70S Ribosome.
• Chain: ED
• Resolution: 3.55 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	ED	L10 S11 K14 R15 H16 R17 Q18 S19 R22 R23 L24 R25 N26 K27 A28 S31 K34 T35 K38 K39 K54 R57 E60 S61 D64 K65 K68 S70 H73 K74 N75 A78 R79 K81 S82 R83 M85 R86 R89 G101 G102 G103 L104 S105 A106	L3 S4 K7 R8 H9 R10 Q11 S12 R15 R16 L17 R18 N19 K20 A21 S24 K27 T28 K31 K32 K47 R50 E53 S54 D57 K58 K61 S63 H66 K67 N68 A71 R72 K74 S75 R76 M78 R79 R82 G94 G95 G96 L97 S98 A99
BS02	MG	ED	K81 S82 M85	K74 S75 M78

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6bok, PDBe:6bok, PDBj:6bok
• PDBsum: 6bok
• PubMed: 29731232
• UniProt: P62661|RS20_THET2 Small ribosomal subunit protein bS20 (Gene Name=rpsT)