Structure of PDB 6bok Chain EC |
>6bokEC (length=69) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence] |
MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFV DTEGRVERFQRRYGDSYRK |
|
PDB | 6bok Conformational Control of Translation Termination on the 70S Ribosome. |
Chain | EC |
Resolution | 3.55 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
EC |
M1 K2 H6 |
M1 K2 H6 |
|
|
|
|