Structure of PDB 6b4v Chain EC

Receptor sequence
>6b4vEC (length=60) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MPRLKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKV
AHLVRVEVVE
3D structure
PDB6b4v Mechanism of Inhibition of Translation Termination by Blasticidin S.
ChainEC
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna EC K10 S11 I13 G14 P16 K17 K20 A21 A22 K24 A25 R29 R30 L31 P41 A42 G45 N46 K49 K10 S11 I13 G14 P16 K17 K20 A21 A22 K24 A25 R29 R30 L31 P41 A42 G45 N46 K49
BS02 rna EC Y15 Q19 H52 Y15 Q19 H52
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6b4v, PDBe:6b4v, PDBj:6b4v
PDBsum6b4v
PubMed29366636
UniProtQ72I22|RL30_THET2 Large ribosomal subunit protein uL30 (Gene Name=rpmD)

[Back to BioLiP]