Structure of PDB 4v4g Chain EC

Receptor sequence
>4v4gEC (length=206) Species: 562 (Escherichia coli) [Search protein sequence]
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAG
LARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVAL
NVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKV
IVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAY
IFLGEV
3D structure
PDB4v4g Structural basis for the control of translation initiation during stress.
ChainEC
Resolution11.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna EC G2 N3 R127 V153 S154 G155 R156 A160 E161 Q162 A163 R172 P174 L175 H176 R179 R190 T191 T192 Y193 G194 V195 L196 G197 G1 N2 R126 V152 S153 G154 R155 A159 E160 Q161 A162 R171 P173 L174 H175 R178 R189 T190 T191 Y192 G193 V194 L195 G196
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 18:01:59 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4g', asym_id = 'EC', title = 'Structural basis for the control of translation initiation during stress.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4g', asym_id='EC', title='Structural basis for the control of translation initiation during stress.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003676,0003723,0003735,0006412', uniprot = '', pdbid = '4v4g', asym_id = 'EC'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0003723,0003735,0006412', uniprot='', pdbid='4v4g', asym_id='EC')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>