Structure of PDB 4v4g Chain EB

Receptor sequence
>4v4gEB (length=234) Species: 562 (Escherichia coli) [Search protein sequence]
VKELLEAGVHFGHERKRWNPKFARYIYAERNGIHIIDLQKTMEELERTFR
FIEDLAMRGGTILFVGTKKQAQDIVRMEAERAGMPYVNQRWLGGMLTNFK
TISQRVHRLEELEALFASPEIEERPKKEQVRLKHELERLQKYLSGFRLLK
RLPDAIFVVDPTKEAIAVREARKLFIPVIALADTDSDPDLVDYIIPGNDD
AIRSIQLILSRAVDLIIQARGGVVEPSPSYALVQ
3D structure
PDB4v4g Structural basis for the control of translation initiation during stress.
ChainEB
Resolution11.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna EB W97 L98 G99 G100 T103 N104 T107 I108 R111 V112 R114 K133 H140 R144 W91 L92 G93 G94 T97 N98 T101 I102 R105 V106 R108 K127 H134 R138
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 17:39:27 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4g', asym_id = 'EB', title = 'Structural basis for the control of translation initiation during stress.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4g', asym_id='EB', title='Structural basis for the control of translation initiation during stress.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0015935', uniprot = '', pdbid = '4v4g', asym_id = 'EB'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0015935', uniprot='', pdbid='4v4g', asym_id='EB')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>