Structure of PDB 8rdw Chain E9

Receptor sequence

>8rdwE9 (length=199) Species: 45610 (Psychrobacter urativorans)

MDLKTVTGAAVELSDTAFGREFNEALVHQVVTAYLAGGRQGTRAQKTRAE
VSGGGIKPWRQKGTGRARAGSIRSPIWRGGGRAFAAKPQDWSQKVNRKMY
RGAMQCILAELIRQERLILVEELTISAPKTKELIAKLSELNAPRALIITK
EVDENLYLAARNIPHVNVLDTSEVDPVSLIAFDKVIMSVEAAKQFEEAL

3D structure

• PDB: 8rdw A new family of bacterial ribosome hibernation factors
• Chain: E9
• Resolution: 2.74 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E9	R20 N23 H28 Q29 T32 Y34 L35 G37 G38 R39 Q40 T42 R43 A44 Q45 K46 R48 A49 V51 S52 G53 I56 K57 Q61 K62 G63 G65 R66 A67 R68 A69 G70 R73 S74 P75 I76 W77 R78 G79 R82 F84 P88 Q89 W91 Q93 K94 N96 R97 K98 M99 Y100 R101 P128 K129 T130 K131 I134 L158 R161 N162 P164 H165	R20 N23 H28 Q29 T32 Y34 L35 G37 G38 R39 Q40 T42 R43 A44 Q45 K46 R48 A49 V51 S52 G53 I56 K57 Q61 K62 G63 G65 R66 A67 R68 A69 G70 R73 S74 P75 I76 W77 R78 G79 R82 F84 P88 Q89 W91 Q93 K94 N96 R97 K98 M99 Y100 R101 P128 K129 T130 K131 I134 L158 R161 N162 P164 H165

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8rdw, PDBe:8rdw, PDBj:8rdw
• PDBsum: 8rdw
• PubMed: 38355796
• UniProt: A0A0M4U627