Structure of PDB 4wqr Chain E8

Receptor sequence

>4wqrE8 (length=113) Species: 300852 (Thermus thermophilus HB8)

MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKV
LESAAANAVNNHDMLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRT
SHITVILGEKHGK

3D structure

• PDB: 4wqr Structural insights into the translational infidelity mechanism.
• Chain: E8
• Resolution: 3.15 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E8	K4 I6 A7 R8 Y9 R11 S13 R15 K16 R18 K41 R42 K49 S53 A56 N57 N60 N61 H62 D77 E78 P80 K83 R84 P87 R88 A89 R90 G91 R92 D94 I96 K97 K98 R99 H102	K4 I6 A7 R8 Y9 R11 S13 R15 K16 R18 K41 R42 K49 S53 A56 N57 N60 N61 H62 D77 E78 P80 K83 R84 P87 R88 A89 R90 G91 R92 D94 I96 K97 K98 R99 H102
BS02	MG	E8	I24 R25 G26 K27 V71	I24 R25 G26 K27 V71

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4wqr, PDBe:4wqr, PDBj:4wqr
• PDBsum: 4wqr
• PubMed: 26037619
• UniProt: Q5SHP3|RL22_THET8 Large ribosomal subunit protein uL22 (Gene Name=rplV)