Structure of PDB 8rdv Chain E5

Receptor sequence

>8rdvE5 (length=156) Species: 45610 (Psychrobacter urativorans) [Search protein sequence]

GLVERLVTVDRVAKVVKGGRIFSFTALTVVGDGNGRVGFGRGKAREVPAA
IQKALEAAKRNMITVELNDATLHHPIKARHGASKVYMQPASEGTGVIAGG
AMRAVLEVAGVKDVLTKCYGSTNTANVVRATFNGLRDMSTPEKMAAKRGK
SVDEIL

3D structure

PDB

8rdv A bacterial ribosome hibernation factor with evolutionary connections to eukaryotic protein synthesis

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E5	V26 A27 K28 V29 V30 K31 G32 R34 R55 K57 R59 K67 R74 R93 H94 G95 A96 Y100 Q102 A104 S105 T108 A112 G113 L129 T130 K131 C132 Y133 S135 T136 N137 N140	V12 A13 K14 V15 V16 K17 G18 R20 R41 K43 R45 K53 R60 R79 H80 G81 A82 Y86 Q88 A90 S91 T94 A98 G99 L115 T116 K117 C118 Y119 S121 T122 N123 N126

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8rdv, PDBe:8rdv, PDBj:8rdv
PDBsum	8rdv
PubMed	38355796
UniProt	A0A0M3V8J0

[Back to BioLiP]