Structure of PDB 8rct Chain E2

Receptor sequence

>8rctE2 (length=158) Species: 562 (Escherichia coli)

ELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAA
IQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGG
AMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGK
SVEEILGK

3D structure

• PDB: 8rct Transient disome complex formation in native polysomes during ongoing protein synthesis captured by cryo-EM.
• Chain: E2
• Resolution: 5.32 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E2	N19 V21 S22 K23 T24 V25 K26 G27 R29 Y50 K52 K62 E65 R69 T90 Q97 A99 S100 A107 G108 R112 A125 K126 A127 Y128 S130 T131 N132 I134 N135 R138	N10 V12 S13 K14 T15 V16 K17 G18 R20 Y41 K43 K53 E56 R60 T81 Q88 A90 S91 A98 G99 R103 A116 K117 A118 Y119 S121 T122 N123 I125 N126 R129
BS02	rna	E2	R20 R29 F31 F33 V56 P57	R11 R20 F22 F24 V47 P48

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0046677 response to antibiotic
• GO:1990145 maintenance of translational fidelity

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8rct, PDBe:8rct, PDBj:8rct
• PDBsum: 8rct
• PubMed: 38409277
• UniProt: P0A7W1|RS5_ECOLI Small ribosomal subunit protein uS5 (Gene Name=rpsE)