Structure of PDB 7oyb Chain E2

Receptor sequence

>7oybE2 (length=261) Species: 7955 (Danio rerio)

ARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNR
LKYALTGDEVKKICMQRFIKIDGKVRTDITYPTGFMDVVSIEKTGENFRL
IYDVKGRFTVHRITNEEAKYKLCKVRKILIGTKGIPHLVTHDARTIRYPD
PLIKVNDTIRIDLDTGKITDFIKFETGNMCMVTGGANLGRIGVITNREKH
PGSFDVVHVKDSIGNSFATRLSNIFVIGKGNKPWVSLPRGKGVRLTIAEE
RDKRLAAKQSS

3D structure

• PDB: 7oyb A molecular network of conserved factors keeps ribosomes dormant in the egg.
• Chain: E2
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E2	R3 G4 P5 K6 K7 H8 K10 V12 K16 D21 K22 L23 T24 G25 V26 F27 P29 R30 T33 G34 P35 H36 K37 L38 R49 T57 G58 D59 M66 K75 R77 K106 R108 V111 H112 R113 K128 I129 I131 G132 K134 G135 V140 A144 R145 T146 R148 K155 G186 A187 H201 P202 G203 R240 I248 R255 A258 K259 S262	R2 G3 P4 K5 K6 H7 K9 V11 K15 D20 K21 L22 T23 G24 V25 F26 P28 R29 T32 G33 P34 H35 K36 L37 R48 T56 G57 D58 M65 K74 R76 K105 R107 V110 H111 R112 K127 I128 I130 G131 K133 G134 V139 A143 R144 T145 R147 K154 G185 A186 H200 P201 G202 R239 I247 R254 A257 K258 S261

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation
• GO:0007420 brain development
• GO:0042274 ribosomal small subunit biogenesis
• GO:0043009 chordate embryonic development

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0032040 small-subunit processome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7oyb, PDBe:7oyb, PDBj:7oyb
• PDBsum: 7oyb
• PubMed: 36653451
• UniProt: Q642H9|RS4X_DANRE Small ribosomal subunit protein eS4 (Gene Name=rps4x)