Structure of PDB 6tsu Chain E2 |
>6tsuE2 (length=84) Species: 1415160 (Rhodobacter capsulatus DE442) [Search protein sequence] |
MDVFAKHAVSLESPAVRHYEITPSDSTDLARRPRALRVQTGGTLVLRDET GITVTYTVFAGEILPVRPVRVLATGTTATAVGWE |
|
PDB | 6tsu Structure and mechanism of DNA delivery of a gene transfer agent. |
Chain | E2 |
Resolution | 3.42 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
E2 |
E12 P14 A35 |
E12 P14 A35 |
|
|
|