Structure of PDB 6gzx Chain E1

Receptor sequence

>6gzxE1 (length=208) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MKEVAVYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTAS
TKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYT
LPKKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDG
SESVLLVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWE
VFQNRIGG

3D structure

PDB

6gzx Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.

Chain

Resolution

4.57 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E1	L32 Q40 L41 K43 R44 R45 R46 T48 A49 T51 K52 T53 R54 A58 Y59 S60 R62 Q67 K68 H69 G71 A73 R74 H75 G76 P81 I82 F83 V84 G85 V88 V89 F90 Y97 Y99 T100 L101 P102 K103 K104 R106 G134 K135 T136 R165 R168 N169 T175 E179 G180 Y184 R188 R205	L32 Q40 L41 K43 R44 R45 R46 T48 A49 T51 K52 T53 R54 A58 Y59 S60 R62 Q67 K68 H69 G71 A73 R74 H75 G76 P81 I82 F83 V84 G85 V88 V89 F90 Y97 Y99 T100 L101 P102 K103 K104 R106 G134 K135 T136 R165 R168 N169 T175 E179 G180 Y184 R188 R205

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6gzx, PDBe:6gzx, PDBj:6gzx
PDBsum	6gzx
PubMed	30301898
UniProt	Q5SHN9\|RL4_THET8 Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]