Structure of PDB 8zee Chain E

Receptor sequence

>8zeeE (length=78) Species: 3055 (Chlamydomonas reinhardtii)

PVERPFSDILTSIRYWVIHSITVPALFIAGWLFVSTGLAYDVFGTPRPNE
YFTEDRQEAPLITDRFNALEQVKKLSGN

3D structure

• PDB: 8zee Structural basis for an early stage of the photosystem II repair cycle in Chlamydomonas reinhardtii.
• Chain: E
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	E	I13 R18 I22 H23 T26	I9 R14 I18 H19 T22

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0046872 metal ion binding

Biological Process

• GO:0015979 photosynthesis

Cellular Component

• GO:0009507 chloroplast
• GO:0009523 photosystem II
• GO:0009535 chloroplast thylakoid membrane
• GO:0009536 plastid
• GO:0009579 thylakoid
• GO:0016020 membrane

External links

• PDB: RCSB:8zee, PDBe:8zee, PDBj:8zee
• PDBsum: 8zee
• PubMed: 38890314
• UniProt: P48268|PSBE_CHLRE Cytochrome b559 subunit alpha (Gene Name=psbE)