Structure of PDB 8why Chain E

Receptor sequence

>8whyE (length=275) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]

GIRKYKPTTPGRRGASVSDFAEITRSTPEKSLVRPLHGKGGRNAHGRITT
RHKGGGHKRAYRVIDFRRHDKDGVNAKVAHIEYDPNRTANIALLHYLDGE
KRYIIAPQGLKQGDVIESGANADIKPGNNLPLRNIPAGTVIHAVELRPGG
GAKLARSAGVSIQLLGKEGTYAALRMPSGEIRRVDVRCRATVGEVGNAEQ
SNINWGKAGRMRWKGKRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWG
KPEGRTRKPNKPSDKLIVRRRRTGK

3D structure

PDB

8why Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	R4 K7 P8 T10 P11 R13 R14 F21 K31 P36 G39 G42 R43 N44 A45 H46 G47 R48 I49 T50 T51 R52 K54 G56 H58 K59 R60 A61 Y62 R63 Y84 P86 N87 R88 D99 G100 K102 L147 R148 G150 K154 L155 A156 R157 S158 A159 G160 V161 M177 P178 S179 E181 R183 A199 Q201 S202 N205 W206 G207 K208 A209 G210 R211 M212 R213 W214 R218 P219 T220 V221 R222 G223 V224 V225 M226 N227 V229 D230 H231 H233 G235 G236 E237 G238 K239 T240 S241 G243 R244 H245 P246 P249 W250 E254 G255 R256 T257 R258 S264 K266 R271 R272 T274	R3 K6 P7 T9 P10 R12 R13 F20 K30 P35 G38 G41 R42 N43 A44 H45 G46 R47 I48 T49 T50 R51 K53 G55 H57 K58 R59 A60 Y61 R62 Y83 P85 N86 R87 D98 G99 K101 L146 R147 G149 K153 L154 A155 R156 S157 A158 G159 V160 M176 P177 S178 E180 R182 A198 Q200 S201 N204 W205 G206 K207 A208 G209 R210 M211 R212 W213 R217 P218 T219 V220 R221 G222 V223 V224 M225 N226 V228 D229 H230 H232 G234 G235 E236 G237 K238 T239 S240 G242 R243 H244 P245 P248 W249 E253 G254 R255 T256 R257 S263 K265 R270 R271 T273

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8why, PDBe:8why, PDBj:8why
PDBsum	8why
PubMed	38245551
UniProt	A0QSD4\|RL2_MYCS2 Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]