Structure of PDB 8wh9 Chain E

Receptor sequence
>8wh9E (length=98) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
PHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB8wh9 Molecular basis of chromatin remodelling by DDM1 involved in plant DNA methylation.
ChainE
Resolution3.31 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E R42 T45 R72 R83 F84 Q85 V117 T118 R5 T8 R35 R46 F47 Q48 V80 T81
BS02 dna E R40 F41 G44 V46 K64 L65 R69 R83 R3 F4 G7 V9 K27 L28 R32 R46
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009536 plastid
GO:0010369 chromocenter

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8wh9, PDBe:8wh9, PDBj:8wh9
PDBsum8wh9
PubMed38413824
UniProtP59226|H31_ARATH Histone H3.1 (Gene Name=HTR2)

[Back to BioLiP]