Structure of PDB 8wdu Chain E

Receptor sequence
>8wduE (length=41) Species: 572477 (Allochromatium vinosum DSM 180) [Search protein sequence]
MTGLTEEEAKEFHGIFTQSMTMFFGIVIIAHILAWLWRPWL
3D structure
PDB8wdu High-resolution structure and biochemical properties of the LH1-RC photocomplex from the model purple sulfur bacterium, Allochromatium vinosum
ChainE
Resolution2.24 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL E M28 F29 V33 A36 H37 M22 F23 V27 A30 H31
BS02 BCL E F30 V33 H37 W41 W46 F24 V27 H31 W35 W40
BS03 CRT E E14 E17 F18 I21 F22 S25 M26 F30 E8 E11 F12 I15 F16 S19 M20 F24
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wdu, PDBe:8wdu, PDBj:8wdu
PDBsum8wdu
PubMed38347078
UniProtD3RP68

[Back to BioLiP]