Structure of PDB 8uua Chain E

Receptor sequence

>8uuaE (length=203) Species: 1642 (Listeria innocua) [Search protein sequence]

LSLLKQDGTNAGEITLNDTVFGIEPNEKVVVDVILSQRASLRQGTHKVKN
RSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYAYKLPK
KVRRLAIKSILSSKVNEEKLVVLEGLTFDAPKTKEFAAFLKNISVDTKAL
IVVAGESENVELSARNLQGITVIPAESISVLEVAKHDKLIITKAAVEKVE
EVL

3D structure

PDB

8uua Mechanistic insights into the alternative ribosome recycling by HflXr.

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	R41 R45 Q46 T48 K52 N53 R54 S55 V57 R58 R62 K63 Q67 K68 G69 G71 R72 A73 R74 Q75 G76 Q82 W83 R84 V88 V89 F90 P92 R95 Y99 K103 K104 R106 P134 K135 T136 K137 R168 N169 Q171 S180	R38 R42 Q43 T45 K49 N50 R51 S52 V54 R55 R59 K60 Q64 K65 G66 G68 R69 A70 R71 Q72 G73 Q79 W80 R81 V85 V86 F87 P89 R92 Y96 K100 K101 R103 P131 K132 T133 K134 R165 N166 Q168 S177
BS02	MG	E	K103 K104	K100 K101

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8uua, PDBe:8uua, PDBj:8uua
PDBsum	8uua
PubMed	38407413
UniProt	A0A0U4VSH7

[Back to BioLiP]