Structure of PDB 8uri Chain E

Receptor sequence

>8uriE (length=86) Species: 562 (Escherichia coli) [Search protein sequence]

ANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAF
NEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA

3D structure

PDB

8uri Escherichia coli transcription-translation coupled complex class A (TTC-A) containing RfaH bound to ops signal, mRNA with a 21 nt long spacer, and fMet-tRNAs in E-site and P-site of the ribosome

Chain

Resolution

5.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	A2 N3 I4 K5 S6 A7 K9 R10 Q13 A17 R18 H20 N21 S23 R25 S26 M27 R29 T30 K33 K34 Y36 P56 D59 R60 H68 K69 N70 K71 A73 R74 K76 N78 T80 Q82	A1 N2 I3 K4 S5 A6 K8 R9 Q12 A16 R17 H19 N20 S22 R24 S25 M26 R28 T29 K32 K33 Y35 P55 D58 R59 H67 K68 N69 K70 A72 R73 K75 N77 T79 Q81

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8uri, PDBe:8uri, PDBj:8uri
PDBsum	8uri
PubMed	39117885
UniProt	C3TRH7

[Back to BioLiP]