Structure of PDB 8tof Chain E

Receptor sequence

>8tofE (length=253) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

LGGRCLAFHGPLMYEAKILKIWDPSSKMYTSIPEEIINGKCFFIHYQGWK
SSWDEWVGYDRIRAYNEENIAMKKRLANEAKEAKKSLLEQQKKKKLISLQ
IPIKLKSVLVDDWEYVTKDKKICRLPADVTVEMVLNKYEHEVSQELESPG
SQSQLSEYCAGLKLYFDKCLGNMLLYRLERLQYDELLKKSSKDQKPLVPI
RIYGAIHLLRLISVLPELISSTTMDLQSCQLLIKQTEDFLVWLLMHVDEY
FND

3D structure

PDB

8tof Structure of the complete Saccharomyces cerevisiae Rpd3S-nucleosome complex.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	E	H80 Q82 G83 W84 K85 K130	H45 Q47 G48 W49 K50 K95

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0035064	methylated histone binding

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0006281	DNA repair
GO:0006325	chromatin organization
GO:0006334	nucleosome assembly
GO:0006335	DNA replication-dependent chromatin assembly
GO:0006337	nucleosome disassembly
GO:0006338	chromatin remodeling
GO:0006351	DNA-templated transcription
GO:0006355	regulation of DNA-templated transcription
GO:0006357	regulation of transcription by RNA polymerase II
GO:0006368	transcription elongation by RNA polymerase II
GO:0009889	regulation of biosynthetic process
GO:0030174	regulation of DNA-templated DNA replication initiation
GO:0032968	positive regulation of transcription elongation by RNA polymerase II
GO:0043487	regulation of RNA stability
GO:0045892	negative regulation of DNA-templated transcription
GO:0060195	negative regulation of antisense RNA transcription

	Cellular Component
GO:0000123	histone acetyltransferase complex
GO:0005634	nucleus
GO:0032221	Rpd3S complex
GO:0035267	NuA4 histone acetyltransferase complex
GO:1990453	nucleosome disassembly/reassembly complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8tof, PDBe:8tof, PDBj:8tof
PDBsum	8tof
PubMed	38065958
UniProt	Q12432\|EAF3_YEAST Chromatin modification-related protein EAF3 (Gene Name=EAF3)

[Back to BioLiP]