Structure of PDB 8tgy Chain E |
>8tgyE (length=104) Species: 2044939 (Clostridia bacterium) [Search protein sequence] |
MAWLILIIAGIFEVVWAIALKYSNGFTRLIPSMITLIGMLISFYLLSQAT KTLPIGTAYAIWTGIGALGAVICGIIFFKEPLTALRIVFMILLLTGIIGL KATS |
|
PDB | 8tgy Transport of metformin metabolites by guanidinium exporters of the Small Multidrug Resistance family. |
Chain | E |
Resolution | 2.18 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
9U1 |
E |
E13 F43 W62 |
E13 F43 W62 |
|
|
|
|